PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496024.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family NF-YB
Protein Properties Length: 154aa    MW: 17243.3 Da    PI: 6.7553
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496024.2genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1291.7e-40688486
           NF-YB  4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                     ++ lPianv+rimk+ lP nakisk++ke++qe v+efisfvt+eas+kcq+e+rk++ngdd++wal++lGf++y+e++ ++
  XP_004496024.2  6 GEKTLPIANVGRIMKQNLPPNAKISKESKELMQESVTEFISFVTGEASEKCQKENRKSVNGDDICWALCSLGFDNYAEAIGKF 88
                    5789**************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-38587IPR009072Histone-fold
SuperFamilySSF471131.71E-30889IPR009072Histone-fold
PfamPF008081.5E-24973IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.9E-123755No hitNo description
PRINTSPR006151.9E-125674No hitNo description
PRINTSPR006151.9E-127593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MKSGDGEKTL PIANVGRIMK QNLPPNAKIS KESKELMQES VTEFISFVTG EASEKCQKEN  60
RKSVNGDDIC WALCSLGFDN YAEAIGKFGS EQAFNHYKNR YIVRDYYSLN EINFAKFNKV  120
ITLNSLSQNI AHSTNSICHV SSNLNSNDLD CSFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-35190188Transcription factor HapC (Eurofung)
4g92_B5e-35190188Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1514262e-76AC151426.32 Medicago truncatula clone mth2-6o22, complete sequence.
GenBankAC1612412e-76AC161241.18 Medicago truncatula clone mth2-193c3, complete sequence.
GenBankJQ9182842e-76JQ918284.1 Medicago truncatula nuclear transcription factor Y subunit B11 (NF-YB11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496024.21e-112PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO040271e-39NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLG7I8545e-51G7I854_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA20G37870.21e-45(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.18e-41nuclear factor Y, subunit B4